Protein coding transcript 1224

• Transcript: Ll_transcript_495712
• CDS coordinates: 783-1445 (+)
• Peptide sequence: MQSTEALSAMEVEAVASEPKLLPPKPEFAPLKPHEMSDGQVQFRKVSVPPHRYTPLKKAWMDIYTPVYEQMKIDIRMNLKARKVELKTRHDTPDISNLQKCADFVHAFMLGFDVIDAIALLRLDELYVESFEVKDVKTLRGDHLSRAIGRLSGKGGKTKFAIENATKTRVVIADSKIHILGSFANIKIARDSLCSLIMGSPAGKVYSKLRAVTARLAERF*
• ORF Type: complete

Annotations of Ll_transcript_495712

• Blastp: RNA-binding protein pno1 from Sophophora with 60% of identity
• Blastx: RNA-binding protein pno1 from Sophophora with 59.73% of identity
• Eggnog: Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly (By similarity)(COG1094)
• Kegg: Link to kegg annotations (Dmel_CG11738)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447032.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;