Transcript | Ll_transcript_349136 |
---|---|
CDS coordinates | 3-434 (+) |
Peptide sequence | YAPNLTSYAIVSLDLGKESCQELLQPDYGEVNVLSFSLGVLKNCLSIIVHYEEGFSDVWLMNDYGKKESWTKFFSLPCLGNPQVFPYGKVICIYEDEEVLLEFDSELAIYNFRNETFNFPEVPDFYGWPEPQIYVESLISPCS* |
ORF Type | 5prime_partial |
Blastp | F-box/kelch-repeat protein At3g23880 from Arabidopsis with 30.47% of identity |
---|---|
Blastx | F-box/kelch-repeat protein At3g23880 from Arabidopsis with 30.47% of identity |
Eggnog | F-box Kelch-repeat protein(ENOG410Z2HM) |
Kegg | Link to kegg annotations (AT3G23880) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439762.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer