Transcript | Ll_transcript_349156 |
---|---|
CDS coordinates | 203-559 (+) |
Peptide sequence | MSQISHGYDNNSPKNEPHTIPDGDSLHAPLPYIPFDLIIEILSRVPVKSLIQFKCVCKSWKTLISNPEFAKKHFSTFHHHHHLLLSINDALNNLIVKLYSFPSIFETPPPISTQFVFQ* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | F-box/kelch-repeat protein At4g19930 from Arabidopsis with 56.52% of identity |
Eggnog | f-box family(ENOG41104KB) |
Kegg | Link to kegg annotations (AT4G19930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439762.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer