Protein coding transcript 122449

• Transcript: Ll_transcript_350662
• CDS coordinates: 647-1168 (+)
• Peptide sequence: MDGDLWEKVLIPDNVYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKIVLQNSAFSGNFNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGDMAVEAQLYEEAFAIFKKFNLNVQAVNVLLDNIHSIDRAVEFAFRVEEDAVWSQVAKAQLRDGLVSDA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_350662

• Blastp: Clathrin heavy chain 1 from Arabidopsis with 93.68% of identity
• Blastx: Clathrin heavy chain 1 from Arabidopsis with 86.89% of identity
• Eggnog: clathrin heavy chain(ENOG410XPH1)
• Kegg: Link to kegg annotations (AT3G11130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416840.1)
• Pfam: Region in Clathrin and VPS (PF00637.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;