Protein coding transcript 1225

• Transcript: Ll_transcript_495690
• CDS coordinates: 189-797 (+)
• Peptide sequence: MMVMGSSSFFSPLISISHNPLHSSLFISPSLTNRRKPNLIVAKSNGSDSADASDRFISALCYFYPFFDGVQYGKYVITQFYPLQAVIQPLVPAIRVFKSFPFNGFLVFFTLYFVVVRNPNFSRYVRFNTMQAIVLDVLLIFPDLLERSFNPKGGLGLDFIMSLDSTVFLFLFVSLIYGSSSCLLGQIPRLPIVADAADRQVL*
• ORF Type: complete

Annotations of Ll_transcript_495690

• Blastp: Protein TIC 20-v, chloroplastic from Arabidopsis with 68.93% of identity
• Blastx: Protein TIC 20-v, chloroplastic from Arabidopsis with 75.71% of identity
• Eggnog: protein transport(ENOG4111UMD)
• Kegg: Link to kegg annotations (AT5G55710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460477.1)
• Pfam: Chloroplast import apparatus Tic20-like (PF16166.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;