Protein coding transcript 122507

• Transcript: Ll_transcript_351117
• CDS coordinates: 1-327 (+)
• Peptide sequence: GADIHVIVKIESADSIPNLHSIITASDGAMVARGDLGAELPIEEVPFLQEEIIGLCRSMGKAVIVATNMLESMIVHPTPTRAEVSDIAIAVREGSDGIMLSGETAHGK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_351117

• Blastp: Plastidial pyruvate kinase 2 from Arabidopsis with 95.37% of identity
• Blastx: Plastidial pyruvate kinase 2 from Arabidopsis with 92.11% of identity
• Eggnog: Pyruvate kinase(COG0469)
• Kegg: Link to kegg annotations (AT5G52920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452770.1)
• Pfam: Pyruvate kinase, barrel domain (PF00224.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;