Transcript | Ll_transcript_351117 |
---|---|
CDS coordinates | 1-327 (+) |
Peptide sequence | GADIHVIVKIESADSIPNLHSIITASDGAMVARGDLGAELPIEEVPFLQEEIIGLCRSMGKAVIVATNMLESMIVHPTPTRAEVSDIAIAVREGSDGIMLSGETAHGK* |
ORF Type | 5prime_partial |
Blastp | Plastidial pyruvate kinase 2 from Arabidopsis with 95.37% of identity |
---|---|
Blastx | Plastidial pyruvate kinase 2 from Arabidopsis with 92.11% of identity |
Eggnog | Pyruvate kinase(COG0469) |
Kegg | Link to kegg annotations (AT5G52920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452770.1) |
Pfam | Pyruvate kinase, barrel domain (PF00224.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer