Transcript | Ll_transcript_348903 |
---|---|
CDS coordinates | 2115-2507 (+) |
Peptide sequence | MRRQLWFDPTEDHIYSILWKTHQIMTKLAHGLLSGKYSTPASQNDENASVASSTLTDKQEGIPPRMFKAVIAASHPEFSSMRQQDALEFFLHFIDQVERANSGKTELDPSRSFKFGIEDRILCSSGKVAYN |
ORF Type | 3prime_partial |
Blastp | Ubiquitin carboxyl-terminal hydrolase 14 from Arabidopsis with 68.22% of identity |
---|---|
Blastx | Probable xyloglucan endotransglucosylase/hydrolase protein 8 from Arabidopsis with 65.48% of identity |
Eggnog | ubiquitin carboxyl-terminal hydrolase(COG5207) |
Kegg | Link to kegg annotations (AT3G20630) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423202.1) |
Pfam | Ubiquitin carboxyl-terminal hydrolase (PF00443.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer