Protein coding transcript 122530

• Transcript: Ll_transcript_348897
• CDS coordinates: 1819-2478 (+)
• Peptide sequence: MKLKLVGGDSAGVVTAYYMCSENGAGPERDELDFEFLGNRTGEPYLIQTNIYKNGTGNREMRHQLWFDPTQDYHTYSILWNTHQIVFFVDRVPIRVFKNNGKANNFFPNEKPMYLFSSIWNADEWATRGGLEKTNWKLSPFVSSYKDFSVDACQWKDPYPDCVSTTTNNWWDQYSAWHLSPDQKNDYAWVHRNLVIYDYCTDSQRFPTLPQECSFSPWD*
• ORF Type: complete

Annotations of Ll_transcript_348897

• Blastp: Probable xyloglucan endotransglucosylase/hydrolase protein 8 from Arabidopsis with 83.18% of identity
• Blastx: Probable xyloglucan endotransglucosylase/hydrolase protein 8 from Arabidopsis with 75.25% of identity
• Eggnog: xyloglucan endotransglucosylase hydrolase protein(ENOG410YAVH)
• Kegg: Link to kegg annotations (AT1G11545)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423202.1)
• Pfam: Glycosyl hydrolases family 16 (PF00722.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;