Protein coding transcript 122553

• Transcript: Ll_transcript_350558
• CDS coordinates: 2-889 (+)
• Peptide sequence: RVMGKDVLSDQPITVGSLPQEEPYKSIEQDIIGNILPDEDDLFSGVTDELGYNTHARTNDDFEDFDLFSSGGGMELEGGEHLNSGKRTNGLDGNSVFYGGSKGKLPLGEQPSRTLFVRNINSNVEDSELKSLFEQYGDIRTIYTACKHRGFVMISYYDLRAAQNAMQALQNRPLRSRKLDIHYSIPKANAPEKDIGHGTLMLSGLDSSALNDELKRIFGFYGEIKEIYEYPEMNHHKFIEFYDVRAAEAALRALNRIGIAGKQIKLEPGHPRFAKCLMQQSHNGQDEPSLGQSIID
• ORF Type: internal

Annotations of Ll_transcript_350558

• Blastp: Protein MEI2-like 2 from Oryza sativa with 57.51% of identity
• Blastx: Protein MEI2-like 2 from Oryza sativa with 55.31% of identity
• Eggnog: Rna-binding protein(ENOG4111R9F)
• Kegg: Link to kegg annotations (4330544)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463986.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF13893.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;