Protein coding transcript 122590

• Transcript: Ll_transcript_348580
• CDS coordinates: 90-1064 (+)
• Peptide sequence: MASPVEEAISIELPAPPGWKKKKKFLPKKSGTPKKNEIVFTAPTGEEINNKKQLDKYLRAHPGGPALIEFYWGTGETPRRSSRISEKAKLAPPPESEPPKKRGKNASTSKEEAPQEKKEETKEVEMEEADETKHDKDLEEENNVVNENHDEKGPGDADLSESTHPVEAKAGENADAPNDEEKIVVKDFQDEKRAEDTDVKESTHPGEAKDGENAAILNDGEKSNTADVELQFSKDKIDDNEVEDSEAFQNKDEEKIGQPQEETKKDGEPGFEVEGVSEEEHNRSNHESEGETKEKEATKVIDEQQYKVHDINKTSETELIVNES*
• ORF Type: complete

Annotations of Ll_transcript_348580

• Blastp: Methyl-CpG-binding domain-containing protein 11 from Arabidopsis with 53.73% of identity
• Blastx: Methyl-CpG-binding domain-containing protein 11 from Arabidopsis with 64.79% of identity
• Eggnog: methyl-CpG binding(ENOG410YRVP)
• Kegg: Link to kegg annotations (AT3G15790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440338.1)
• Pfam: Methyl-CpG binding domain (PF01429.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;