Transcript | Ll_transcript_348581 |
---|---|
CDS coordinates | 981-1955 (+) |
Peptide sequence | MASPVEEAISIELPAPPGWKKKKKFLPKKSGTPKKNEIVFTAPTGEEINNKKQLDKYLRAHPGGPALIEFYWGTGETPRRSSRISEKAKLAPPPESEPPKKRGKNASTSKEEAPQEKKEETKEVEMEEADETKHDKDLEEENNVVNENHDEKGPGDADLSESTHPVEAKAGENADAPNDEEKIVVKDFQDEKRAEDTDVKESTHPGEAKDGENAAILNDGEKSNTADVELQFSKDKIDDNEVEDSEAFQNKDEEKIGQPQEETKKDGEPGFEVEGVSEEEHNRSNHESEGETKEKEATKVIDEQQYKVHDINKTSETELIVNES* |
ORF Type | complete |
Blastp | Methyl-CpG-binding domain-containing protein 11 from Arabidopsis with 53.73% of identity |
---|---|
Blastx | Methyl-CpG-binding domain-containing protein 11 from Arabidopsis with 64.79% of identity |
Eggnog | methyl-CpG binding(ENOG410YRVP) |
Kegg | Link to kegg annotations (AT3G15790) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440338.1) |
Pfam | Methyl-CpG binding domain (PF01429.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer