Protein coding transcript 122609

• Transcript: Ll_transcript_349995
• CDS coordinates: 300-665 (+)
• Peptide sequence: MRRPSTLVNLVLVLALFSCSIWTVWSRSSSLCKHTNFEEIRRPHSVSIKEFGAIGDGVTLNTKAFQNAIFYLNSFADKGGAKLFVPAGQWLTGSFDLISHLTLSLDKDAVILGSTVSHSVW*
• ORF Type: complete

Annotations of Ll_transcript_349995

• Blastp: Probable polygalacturonase from Vitis with 60.27% of identity
• Blastx: Probable polygalacturonase from Vitis with 62% of identity
• Eggnog: Glycoside hydrolase family 28(COG5434)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422336.1)
• Pfam: Pectate lyase superfamily protein (PF12708.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;