Protein coding transcript 122610

• Transcript: Ll_transcript_349996
• CDS coordinates: 796-1410 (+)
• Peptide sequence: MISIKSGWDEYGIKFGRPSKNIIIHRLTGQTQTSSGIAIGSEMSGGVSEVYAEDIHMFNSNNSIRIKTSPGRGGYVRNIYISNVTLVNVTTAIRLTGLYGQHPDDGYDPNAQPVIENITINNVIGDQIKNAGIVQGIEGDKFVNICLSNITVNVTSSNPWNCSNVQGYSDNILPEVCVELKERITPDHSSNCYHLSKPEPSSKN*
• ORF Type: complete

Annotations of Ll_transcript_349996

• Blastp: Probable polygalacturonase from Vitis with 43.3% of identity
• Blastx: Probable polygalacturonase from Vitis with 44.86% of identity
• Eggnog: Glycoside hydrolase family 28(COG5434)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422336.1)
• Pfam: Glycosyl hydrolases family 28 (PF00295.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;