Transcript | Ll_transcript_350498 |
---|---|
CDS coordinates | 408-737 (+) |
Peptide sequence | MAKKRKMQLRCRDMEWWMKRRQLPSRLKKRVRHFERQRWTAMGGEDEMELIKDLPEGLRRDIKRYLCLDLIKKVTNLRPNKLNNKEMFERLNLEEESSRLFESWIEEMF* |
ORF Type | complete |
Blastp | Cyclic nucleotide-gated ion channel 2 from Arabidopsis with 82.05% of identity |
---|---|
Blastx | Cyclic nucleotide-gated ion channel 2 from Arabidopsis with 81.4% of identity |
Eggnog | Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE) |
Kegg | Link to kegg annotations (AT5G15410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461471.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer