Protein coding transcript 122657

• Transcript: Ll_transcript_350487
• CDS coordinates: 408-719 (+)
• Peptide sequence: MAKKRKMQLRCRDMEWWMKRRQLPSRLKKRVRHFERQRWTAMGGEDEMELIKDLPEGLRRDIKRYLCLDLIKKVTNLRPNKLNNKEMFERLNLEEESSRLFES*
• ORF Type: complete

Annotations of Ll_transcript_350487

• Blastp: Cyclic nucleotide-gated ion channel 2 from Arabidopsis with 82.05% of identity
• Blastx: Cyclic nucleotide-gated ion channel 2 from Arabidopsis with 81.4% of identity
• Eggnog: Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE)
• Kegg: Link to kegg annotations (AT5G15410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461471.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;