Transcript | Ll_transcript_350806 |
---|---|
CDS coordinates | 249-908 (+) |
Peptide sequence | MWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFTGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLRDAKWGEEDAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTRNPGDQVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSIGNFCICSIAIGMLVEIIVMYPIQQRSYRDGIDNLLVLLIGG |
ORF Type | 3prime_partial |
Blastp | ATPase 8, plasma membrane-type from Arabidopsis with 90.45% of identity |
---|---|
Blastx | ATPase 8, plasma membrane-type from Arabidopsis with 87.78% of identity |
Eggnog | P-type atpase(COG0474) |
Kegg | Link to kegg annotations (AT3G42640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417373.1) |
Pfam | E1-E2 ATPase (PF00122.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer