Protein coding transcript 12278

• Transcript: Ll_transcript_411559
• CDS coordinates: 44-481 (+)
• Peptide sequence: MGSVEVTASQWRLVEVGRVVLFVTGPYAGKLAAIAEIIDHKRVLVDGPASTTEASVPRHSAALSHVSLTRFVIDKLPRAAGTAAVKKQWEAQEIEKKFYSSDYAKKREQVTKRRNLNDFERFKVMRLRKQARFQVRKTLAAAKAA*
• ORF Type: complete

Annotations of Ll_transcript_411559

• Blastp: 60S ribosomal protein L14-A from Saccharomyces with 54.74% of identity
• Blastx: 60S ribosomal protein L14-A from Saccharomyces with 54.74% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YKL006W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003590835.1)
• Pfam: Ribosomal protein L14 (PF01929.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;