Protein coding transcript 123075

• Transcript: Ll_transcript_505235
• CDS coordinates: 1746-2612 (+)
• Peptide sequence: MVHPSKSAKPVPQDRLKSRLIFHDGRFVQRPDPLNALITFTWLPFGFILSIIRVYFNLPLPERIVRYTYEILGINLIIRGHRPPPPSPGTPGNLYVCNHRTALDPIIIAIALGRKVSCVTYSVSKLSRFLSPIPAIALTRDRAADAARITELLEKGDLVVCPEGTTCREPFLLRFSALFAEMSDRIVPVAVNCKQGMFYGTTVRGVKFWDPYFFFMNPRPVYEVNFLDRLPEEISCKVGGKSSIEVANHVQKVLGEVLGFECTGLTRKDKYMLLGGNDGKVESMYSAKK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_505235

• Blastp: Probable glycerol-3-phosphate acyltransferase 8 from Arabidopsis with 79.58% of identity
• Blastx: Glycerol-3-phosphate 2-O-acyltransferase 4 from Arabidopsis with 78.67% of identity
• Eggnog: glycerol-3-phosphate acyltransferase(ENOG4111C4N)
• Kegg: Link to kegg annotations (AT4G00400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432997.1)
• Pfam: Acyltransferase (PF01553.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;