Protein coding transcript 123203

• Transcript: Ll_transcript_504820
• CDS coordinates: 155-574 (+)
• Peptide sequence: MSFESRSLFFFFLFLTLSFASESDHKYQQDDPVTLWVNKVGPYNNPQETYNYYSLPFCHPSSSAEAAHKWGGLGEVLGGNELIDSQIDIKFLRNVDKTVFCQISLDEAKVKQFKGAIENNYWFELFVGMFCFCIFYSLF*
• ORF Type: complete

Annotations of Ll_transcript_504820

• Blastp: Transmembrane 9 superfamily member 1 from Arabidopsis with 90.26% of identity
• Blastx: Transmembrane 9 superfamily member 1 from Arabidopsis with 89.76% of identity
• Eggnog: transmembrane 9 superfamily member(ENOG410XSVB)
• Kegg: Link to kegg annotations (AT1G10950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464006.1)
• Pfam: Endomembrane protein 70 (PF02990.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;