Protein coding transcript 123210

• Transcript: Ll_transcript_505425
• CDS coordinates: 279-839 (+)
• Peptide sequence: MAALSFSVASVVEEVLQQHRTRLKDLDMESRKAEEAAFRRYDAAGWLRKMVGVVAAKDLPAEPSEEEFRLGLRSGIILCNVLNKVQPGAVPKVVETPVDSALVPDKGPLSAFQYFENVRNFLVAIQEIGIPTFEASDLEQGGNSARVVNSALALKSYSEWKQTGGNGVWKFGGTLKPAISTKSFVRK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_505425

• Blastp: Kinesin-like protein KIN-14I from Arabidopsis with 74.87% of identity
• Blastx: Kinesin-like protein KIN-14I from Arabidopsis with 74.87% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT2G47500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428731.1)
• Pfam: Calponin homology (CH) domain (PF00307.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;