Protein coding transcript 123214

• Transcript: Ll_transcript_505429
• CDS coordinates: 1-363 (+)
• Peptide sequence: SSRSHTCLTVHVEGRDLTSGTLLRGCMHLVDLAGSERVDKSEATGDRLKEAQHINKSLSALGDVIASLAQKNSHVPYRNSKLTQLLQDSLGGQAKTLMFVHVSPEIDSIGETISTLKFAER
• ORF Type: internal

Annotations of Ll_transcript_505429

• Blastp: Kinesin-like protein KIN-14I from Arabidopsis with 90.08% of identity
• Blastx: Kinesin-like protein KIN-14I from Arabidopsis with 90.08% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT2G47500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428732.1)
• Pfam: Kinesin motor domain (PF00225.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;