Protein coding transcript 123217

• Transcript: Ll_transcript_505432
• CDS coordinates: 2-502 (+)
• Peptide sequence: RNRAVGATALNDRSSRSHSCLTVHVQGRNLTSGTRLRGCMHLVDLAGSERVDKSEATGDRLKEAQHINKSLSALGDVIASLAQKNQHVPYRNSKLTQLLQDSLGGQAKTLMFVHISPEADSIGETISTLKFAERVATVELGAARVNKDGADVKELKEQVDIQHLPL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_505432

• Blastp: Kinesin-like protein KIN-14I from Arabidopsis with 90.57% of identity
• Blastx: Kinesin-like protein KIN-14I from Arabidopsis with 90.57% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT2G47500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441321.1)
• Pfam: Kinesin motor domain (PF00225.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;