Transcript | Ll_transcript_505432 |
---|---|
CDS coordinates | 2-502 (+) |
Peptide sequence | RNRAVGATALNDRSSRSHSCLTVHVQGRNLTSGTRLRGCMHLVDLAGSERVDKSEATGDRLKEAQHINKSLSALGDVIASLAQKNQHVPYRNSKLTQLLQDSLGGQAKTLMFVHISPEADSIGETISTLKFAERVATVELGAARVNKDGADVKELKEQVDIQHLPL* |
ORF Type | 5prime_partial |
Blastp | Kinesin-like protein KIN-14I from Arabidopsis with 90.57% of identity |
---|---|
Blastx | Kinesin-like protein KIN-14I from Arabidopsis with 90.57% of identity |
Eggnog | Kinesin family member(COG5059) |
Kegg | Link to kegg annotations (AT2G47500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441321.1) |
Pfam | Kinesin motor domain (PF00225.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer