Transcript | Ll_transcript_506666 |
---|---|
CDS coordinates | 109-813 (+) |
Peptide sequence | MASRSSSSLFSSLLRSSLRRSPPQCNFPISSPNISFRPSPLTTRIFPQTEVFKRFESSHGLASVLGCSRLASFQQAAPVPSFCNRFMSTQTNSDDSSSQDSFSTGPNVPPRIKVKRLDKTARHIMQILDKEAVEEVKAQRELPEIKPGYIVQLKVEVPENKRRVSIIKGIVIAKRNAGLNSTFRIRRLVAGVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKKH* |
ORF Type | complete |
Blastp | 50S ribosomal protein L19, chloroplastic from Spinacia with 61.9% of identity |
---|---|
Blastx | 50S ribosomal protein L19, chloroplastic from Spinacia with 61.9% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443996.1) |
Pfam | Ribosomal protein L19 (PF01245.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer