Protein coding transcript 123235

• Transcript: Ll_transcript_506666
• CDS coordinates: 109-813 (+)
• Peptide sequence: MASRSSSSLFSSLLRSSLRRSPPQCNFPISSPNISFRPSPLTTRIFPQTEVFKRFESSHGLASVLGCSRLASFQQAAPVPSFCNRFMSTQTNSDDSSSQDSFSTGPNVPPRIKVKRLDKTARHIMQILDKEAVEEVKAQRELPEIKPGYIVQLKVEVPENKRRVSIIKGIVIAKRNAGLNSTFRIRRLVAGVGIESLFPLYSPNIKEIKVLDKKKVRRAKLYYLRDKMNALKKH*
• ORF Type: complete

Annotations of Ll_transcript_506666

• Blastp: 50S ribosomal protein L19, chloroplastic from Spinacia with 61.9% of identity
• Blastx: 50S ribosomal protein L19, chloroplastic from Spinacia with 61.9% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443996.1)
• Pfam: Ribosomal protein L19 (PF01245.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;