Protein coding transcript 123265

• Transcript: Ll_transcript_505190
• CDS coordinates: 307-999 (+)
• Peptide sequence: MSVDSLVKKAYDNWNQVIEYDGKVFNSKKGSRSLVTPMLLQNNVQEQHYTYQKNRLPYVPSEPNQHLQITNNYSSGPEMSDYPFGRSDNQMVGTSSNNSQIALSGSMNYIPDEHQEVEGTYFQGDWSKQRSGQGLEDIVAEELRVRSSEMLGSDDMQRLLKTINYGHSNEACYTYSLQYEPQMYDSFSEDHSKSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQLTELN*
• ORF Type: complete

Annotations of Ll_transcript_505190

• Blastp: Calmodulin-binding protein 60 E from Arabidopsis with 42.63% of identity
• Blastx: Calmodulin-binding protein 60 E from Arabidopsis with 42.46% of identity
• Eggnog: calmodulin-binding protein(ENOG41114MQ)
• Kegg: Link to kegg annotations (AT2G24300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417146.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;