Protein coding transcript 123267

• Transcript: Ll_transcript_505193
• CDS coordinates: 2376-2894 (+)
• Peptide sequence: MIEGPDGRNLRLHFRSRLSLPLFTGGKVEGEQGAPIHVVLVDADNENVVITGPEASVKLDVVVLEGDFNNEDDEDWTQEEFESHVVKEREGKRPLLTGELQVTLKEGIGTLGELTFTDNSSWIRSRKFRLGLKVASGFCESIRIREAKTEAFTVKDHRGECRVMFLYFLPFL*
• ORF Type: complete

Annotations of Ll_transcript_505193

• Blastp: Calmodulin-binding protein 60 D from Arabidopsis with 82.39% of identity
• Blastx: Calmodulin-binding protein 60 D from Arabidopsis with 70.61% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G25800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463484.1)
• Pfam: Calmodulin binding protein-like (PF07887.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;