Protein coding transcript 123268

• Transcript: Ll_transcript_505163
• CDS coordinates: 684-986 (+)
• Peptide sequence: MKLDVVVLEGSFNNEDDEDWTLEEFESHLVKEREGKRPLLTGELQVSLKEGIGTLGELTFTDNSSWIRSRKFRLGLKVAPGFCESIRIREAKTDAFTVKDH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_505163

• Blastp: Calmodulin-binding protein 60 D from Arabidopsis with 80.2% of identity
• Blastx: Calmodulin-binding protein 60 B from Arabidopsis with 80.66% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G25800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454122.1)
• Pfam: Calmodulin binding protein-like (PF07887.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;