Transcript | Ll_transcript_507403 |
---|---|
CDS coordinates | 996-1406 (+) |
Peptide sequence | MGGVLGKGESPKKVWAPETKLEAKMVEAMQRRESQGSSVKSFNTVILKFPKIDESLRKCKATFEQFDEDSNGAIDQEELKKCFTKLEISFTEEEINDLFEACDINDDLGMKFSEFIVLLCLVYLLKDEPKALHAVS* |
ORF Type | complete |
Blastp | Probable calcium-binding protein CML21 from Arabidopsis with 66.92% of identity |
---|---|
Blastx | Probable calcium-binding protein CML21 from Arabidopsis with 66.92% of identity |
Eggnog | Calcium-binding protein(COG5126) |
Kegg | Link to kegg annotations (AT4G26470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446978.1) |
Pfam | Secreted protein acidic and rich in cysteine Ca binding region (PF10591.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer