Protein coding transcript 123276

• Transcript: Ll_transcript_507406
• CDS coordinates: 334-744 (+)
• Peptide sequence: MGGVLGKGESPKKVWAPETKLEAKMVEAMQRRESQGSSVKSFNTVILKFPKIDESLRKCKATFEQFDEDSNGAIDQEELKKCFTKLEISFTEEEINDLFEACDINDDLGMKFSEFIVLLCLVYLLKDEPKALHAVS*
• ORF Type: complete

Annotations of Ll_transcript_507406

• Blastp: Probable calcium-binding protein CML21 from Arabidopsis with 66.92% of identity
• Blastx: Probable calcium-binding protein CML21 from Arabidopsis with 66.92% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT4G26470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446978.1)
• Pfam: Secreted protein acidic and rich in cysteine Ca binding region (PF10591.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;