Transcript | Ll_transcript_495672 |
---|---|
CDS coordinates | 2-307 (+) |
Peptide sequence | EKTNKKLKELEGELRRIKVIYQSVKRQDNSLQKHFTEASCNLEHLSGKLNSVKLGEEGENSAFYEKSNAPDGDEMLTDNLAIKISEEEKLDCASSPGDVRND |
ORF Type | internal |
Blastp | Protein NETWORKED 2B from Arabidopsis with 45.45% of identity |
---|---|
Blastx | Protein NETWORKED 2B from Arabidopsis with 45.45% of identity |
Eggnog | Kinase interacting(ENOG410Y9Y9) |
Kegg | Link to kegg annotations (AT1G09720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415092.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer