Protein coding transcript 1233

• Transcript: Ll_transcript_495672
• CDS coordinates: 2-307 (+)
• Peptide sequence: EKTNKKLKELEGELRRIKVIYQSVKRQDNSLQKHFTEASCNLEHLSGKLNSVKLGEEGENSAFYEKSNAPDGDEMLTDNLAIKISEEEKLDCASSPGDVRND
• ORF Type: internal

Annotations of Ll_transcript_495672

• Blastp: Protein NETWORKED 2B from Arabidopsis with 45.45% of identity
• Blastx: Protein NETWORKED 2B from Arabidopsis with 45.45% of identity
• Eggnog: Kinase interacting(ENOG410Y9Y9)
• Kegg: Link to kegg annotations (AT1G09720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415092.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;