| Transcript | Ll_transcript_505220 |
|---|---|
| CDS coordinates | 466-867 (+) |
| Peptide sequence | MVPPGPPTPIGGAQSVNASLLRSNSGMLGGQGGPMPSQNSFPSLVSPHTQFNNMNILGNMSNVTSTLNQSFPNGVPNNVLSGPGISQRGVVYTGAETDPLSSVANGMNFSNSSSSFVQANMVNVGGSSGVGQGQ |
| ORF Type | 3prime_partial |
| Blastp | Transcriptional corepressor SEUSS from Arabidopsis with 47.48% of identity |
|---|---|
| Blastx | Transcriptional corepressor SEUSS from Arabidopsis with 49.07% of identity |
| Eggnog | NA(ENOG410XT7C) |
| Kegg | Link to kegg annotations (AT1G43850) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_015934435.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer