Transcript | Ll_transcript_505212 |
---|---|
CDS coordinates | 378-779 (+) |
Peptide sequence | MVPPGPPTPIGGAQSVNASLLRSNSGMLGGQGGPMPSQNSFPSLVSPHTQFNNMNILGNMSNVTSTLNQSFPNGVPNNVLSGPGISQRGVVYTGAETDPLSSVANGMNFSNSSSSFVQANMVNVGGSSGVGQGQ |
ORF Type | 3prime_partial |
Blastp | Transcriptional corepressor SEUSS from Arabidopsis with 47.48% of identity |
---|---|
Blastx | Transcriptional corepressor SEUSS from Arabidopsis with 49.07% of identity |
Eggnog | NA(ENOG410XT7C) |
Kegg | Link to kegg annotations (AT1G43850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016163422.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer