Transcript | Ll_transcript_507465 |
---|---|
CDS coordinates | 3-896 (+) |
Peptide sequence | DSSSKVVRLLYTNSGVGILALGSNGIQKLWKWARNEQNPTGKATAGVVPQHWQPNNGVLMTNDISGVNLEEAVPCIALSKNDSYVMSACGGKVSLFNMMTFKVMTTFMPPPPASTFLAFHPKDNNIIAIGMEDSTIHIYNVRVDEVKSKLKGHQKRITGLAFSTHLNILVSSGADAQLCVWSIDTWEKRKAIPIQLPAGKPPIGDTRVQFHSDQLRLLVVHETQLAIYDASKMDRIRQWVPQDSLSAPISHATYSCNSQLVYATFCDANVGVFDADSLRLRCRIAPSICLPPAASSG* |
ORF Type | 5prime_partial |
Blastp | Topless-related protein 3 from Arabidopsis with 84.83% of identity |
---|---|
Blastx | Topless-related protein 3 from Arabidopsis with 84.83% of identity |
Eggnog | Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein- mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for(ENOG410XP3K) |
Kegg | Link to kegg annotations (AT5G27030) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441181.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer