| Transcript | Ll_transcript_507467 |
|---|---|
| CDS coordinates | 3-518 (+) |
| Peptide sequence | KNDSYVMSACGGKVSLFNMMTFKVMTTFMPPPPASTYLAFHPQDNNIIAIGMEDSTIHIYNVRVDEVKSKLRGHQKRISGLAFSTNLNILVSSGADAQVSLFKRSPLFLRFRMTSRPSRTNRLMSNICFEGSEVFLSGIHIYVICDYSMLLDLLPSVKYSIIGLLIYSELL* |
| ORF Type | 5prime_partial |
| Blastp | Protein TPR1 from Oryza sativa with 68.75% of identity |
|---|---|
| Blastx | Protein TPR1 from Oryza sativa with 68.75% of identity |
| Eggnog | Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein- mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for(ENOG410XP3K) |
| Kegg | Link to kegg annotations (4327709) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019440603.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer