| Transcript | Ll_transcript_505849 |
|---|---|
| CDS coordinates | 734-1228 (+) |
| Peptide sequence | MRKRYLFREAVAPWEKEVISDPCTPKPNPEPFFFDPEGKSDHYFEMQDGVIHVYPNKDSNDELFPVADATTFFTDLHHVLRVIAAGNIRTLCHYRLNLLEQKFNLHLMLNADREFLAQKSAPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKSKLIHMSTTQHA* |
| ORF Type | complete |
| Blastp | AMP deaminase from Arabidopsis with 50.83% of identity |
|---|---|
| Blastx | AMP deaminase from Arabidopsis with 84% of identity |
| Eggnog | adenosine deaminase(COG1816) |
| Kegg | Link to kegg annotations (AT2G38280) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020997259.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer