Protein coding transcript 123399

• Transcript: Ll_transcript_505859
• CDS coordinates: 734-1288 (+)
• Peptide sequence: MRKRYLFREAVAPWEKEVISDPCTPKPNPEPFFFDPEGKSDHYFEMQDGVIHVYPNKDSNDELFPVADATTFFTDLHHVLRVIAAGNIRTLCHYRLNLLEQKFNLHLMLNADREFLAQKSAPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKSKLRKEPDEVVIFRDGTYLTLKEVFESLDLTG*
• ORF Type: complete

Annotations of Ll_transcript_505859

• Blastp: AMP deaminase from Arabidopsis with 50.83% of identity
• Blastx: AMP deaminase from Arabidopsis with 85.78% of identity
• Eggnog: adenosine deaminase(COG1816)
• Kegg: Link to kegg annotations (AT2G38280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020997259.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;