| Transcript | Ll_transcript_504712 |
|---|---|
| CDS coordinates | 1-306 (+) |
| Peptide sequence | KLKEYASVGFVMLLWQKHPGSPKQQNEKSGPKPPLPFNPSQFRKGAYHESLDFVLSLCETSFGLVDVFPTEDRKHALSESLAEINVHLIEAQNTGGVCFPLG |
| ORF Type | internal |
| Blastp | Phosphatidylinositol 4-kinase beta 1 from Arabidopsis with 69.32% of identity |
|---|---|
| Blastx | Phosphatidylinositol 4-kinase beta 1 from Arabidopsis with 69.32% of identity |
| Eggnog | phosphatidylinositol 4-kinase(ENOG410XPH3) |
| Kegg | Link to kegg annotations (AT5G64070) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019430183.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer