Protein coding transcript 123476

• Transcript: Ll_transcript_505774
• CDS coordinates: 73-681 (+)
• Peptide sequence: MDRTFFFLFLFQLCIILSLAKADNLTTSLISKSGDTTSGERHSENYCAMYDICGKRSDDKVLNCPYGSAAVKPNDLLSSKIQSLCPTITGNVCCTEAQFDTLKTQVQQALPFLVGCPACLRNFLNLFCELTCSPDQSLFINVTSVDKVGGNLTVGGIDYFVNDAFGEGLYESCKEVKFGTMNTLALQFLGAGAQNFRGKLYF*
• ORF Type: complete

Annotations of Ll_transcript_505774

• Blastp: Niemann-Pick type C-related protein 1 from Saccharomyces with 37.58% of identity
• Blastx: Niemann-Pick type C-related protein 1 from Saccharomyces with 37.74% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YPL006W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438101.1)
• Pfam: Niemann-Pick C1 N terminus (PF16414.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;