Transcript | Ll_transcript_505774 |
---|---|
CDS coordinates | 73-681 (+) |
Peptide sequence | MDRTFFFLFLFQLCIILSLAKADNLTTSLISKSGDTTSGERHSENYCAMYDICGKRSDDKVLNCPYGSAAVKPNDLLSSKIQSLCPTITGNVCCTEAQFDTLKTQVQQALPFLVGCPACLRNFLNLFCELTCSPDQSLFINVTSVDKVGGNLTVGGIDYFVNDAFGEGLYESCKEVKFGTMNTLALQFLGAGAQNFRGKLYF* |
ORF Type | complete |
Blastp | Niemann-Pick type C-related protein 1 from Saccharomyces with 37.58% of identity |
---|---|
Blastx | Niemann-Pick type C-related protein 1 from Saccharomyces with 37.74% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YPL006W) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438101.1) |
Pfam | Niemann-Pick C1 N terminus (PF16414.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer