Transcript | Ll_transcript_495753 |
---|---|
CDS coordinates | 1-618 (+) |
Peptide sequence | RSQSDGDGMSLFGVSHVWLDHLSLSNCDDGIIDVVAGSTAVTISNCHMARQNDVMLLGASDSFSGDQVMQVTVAFNHFGKGLVQRMPRCRWGYVHIVNNDYTHWLMYAIGGSSHPTILSQGNRFVAPLNPFAKQVTKRDYASESEWKNWNWRSENDLMMNGAFFIESGKSVATPANIDITAKPGTFAASLTRFTGPLKCVVNKPC* |
ORF Type | 5prime_partial |
Blastp | Pectate lyase from Lilium with 61.84% of identity |
---|---|
Blastx | Pectate lyase from Lilium with 61.84% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462690.1) |
Pfam | Pectate lyase (PF00544.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer