Protein coding transcript 123543

• Transcript: Ll_transcript_506398
• CDS coordinates: 947-1708 (+)
• Peptide sequence: MCNPPFFESLEEAGLNPKTSCGGTSKEMVCPGGEKAFITRIIEDSTELKHQFRWFTSMIGRKTNLKYLTSKLWEVGVTIVKTTEFVQGRTSRWGLAWSFLPPIQKSSISLPEKKSNISFLVEDLPSQHGAFNVLEAIKSYFSLYGLSCTLNPSSFTVDVLASKDYCDSILKNELPIINKSINCQPSGETSNGSSLNSSADRLGLRISVFQQSRRTLLVKGSLQDRNSPLSGAFSVIFQKLEEALRNKFYTKLA*
• ORF Type: complete

Annotations of Ll_transcript_506398

• Blastp: U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase from Xenopus with 41.89% of identity
• Blastx: U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase from Danio with 33.84% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (443759)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460068.1)
• Pfam: Protein of unknown function (DUF890) (PF05971.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;