Protein coding transcript 12358

• Transcript: Ll_transcript_412109
• CDS coordinates: 259-777 (+)
• Peptide sequence: MFFSSVTVVESGTRALQYLGLDGENSSIDFDSLKVNLIMTDYSMPEMTGYELLKKIKESSVFREIPVVVMSSENILTRIDSCLEEGAEDFLLKPVKLSDVKRLTDFMRGEGKIAEKQSPKRRQSDNCTPSLSTMFSLTSYHRNITSPELLPSLSPSASPSKKSRVSKKIELC*
• ORF Type: complete

Annotations of Ll_transcript_412109

• Blastp: Two-component response regulator ARR5 from Arabidopsis with 73.98% of identity
• Blastx: Two-component response regulator ARR5 from Arabidopsis with 70.99% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT3G48100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416227.1)
• Pfam: Response regulator receiver domain (PF00072.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;