Transcript | Ll_transcript_507548 |
---|---|
CDS coordinates | 1-729 (+) |
Peptide sequence | GFFVMATGQLFSRTTQALFYNYKEFPIQRMLDFDFLCGRETPSVAGIISPGSEGYQKLFFGQGEIAIPVHANIEAACQAHPTADVFINFASYRSAAASSMAALKQPTIRVVAIIAEGVPESDTKQLIAYARSNSKGGMSNELYNTIACVTDGIYEGIAIGGDVFPGSTLSDHVLRFNSIPQVKMIVVLGELGGRDEYSLVEALKQGKVAKPVVAWVSGTCARLFKSEVQFGHAVCRFFFFFD* |
ORF Type | 5prime_partial |
Blastp | ATP-citrate synthase beta chain protein 1 from Oryza sativa with 75.18% of identity |
---|---|
Blastx | ATP-citrate synthase beta chain protein 1 from Oryza sativa with 71.96% of identity |
Eggnog | Succinyl-CoA ligase ADP-forming subunit alpha(COG0074) |
Kegg | Link to kegg annotations (4325777) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419112.1) |
Pfam | CoA binding domain (PF02629.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer