| Transcript | Ll_transcript_507039 |
|---|---|
| CDS coordinates | 1373-1684 (+) |
| Peptide sequence | MMIDSLPQELRISILQKLYGPLIHGNNVFRGISDDGHAKLMSELIIEHHQKEAKVISLNQACTCFYILVSGEVEVLFEYEDGGEHQVVLLVNSLLGEVGVLYCK |
| ORF Type | 3prime_partial |
| Blastp | Potassium channel KAT6 from Oryza sativa with 37.25% of identity |
|---|---|
| Blastx | Potassium channel AKT1 from Arabidopsis with 37.7% of identity |
| Eggnog | Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019427311.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer