Protein coding transcript 123588

• Transcript: Ll_transcript_507057
• CDS coordinates: 1-324 (+)
• Peptide sequence: PYFRLFINWLLDLGSLEPVTDGANLQEVLFEYEDGGEHQVVLLVNSLLGEVGVLYCKRHPFTIRTRTLSHMVKVNRKTIIDIAMTNAEDIHLIMTNHSHVLLHFLFCY
• ORF Type: internal

Annotations of Ll_transcript_507057

• Blastp: Potassium channel KAT1 from Arabidopsis with 36.36% of identity
• Blastx: Potassium channel KAT1 from Arabidopsis with 36.36% of identity
• Eggnog: Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE)
• Kegg: Link to kegg annotations (AT5G46240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427311.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;