Transcript | Ll_transcript_507059 |
---|---|
CDS coordinates | 2-1381 (+) |
Peptide sequence | MQSPQQLQPMSFLAIDVYAKLVFSILKGSSKLTLLSKILAVTVRFILKDVEERKTSFNPRPYFRLFINWLLDLGSLEPVTDGANLQILTAFANAFHALQPLKVPGFSFAWLELISHRSFMPKMLTGNAQKGWPYIQRLLVDLFQFMEPFLRHAELGDSVRLLYKGTLRVLLVLLHDFPEFLCDYHFTFCDVIPPSCIQMRNIILSAFPRSMRLPDPSTPNLKIDLLQEITQSPRILSEVDAVLKAKLMKADVDEYLKSRQQNSSFLSELKEKLLLSPNEAGSAGTRYNVPLINSLVLYVGMQAIQQLQGRTPHAQSSANAFPLAVFSVGAALDIFQTLIMDLDTEGRYLFLNAVANQLRYPNTHTHYFSFILLYLFAESNQEIIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPRYNLWNRTFIRCAPEIEKLFESVSRSCGGPKPVEESMVPGWV* |
ORF Type | complete |
Blastp | CCR4-NOT transcription complex subunit 1 from Silurana with 56.28% of identity |
---|---|
Blastx | Guanine nucleotide-binding protein subunit beta-2 from Nicotiana with 84.76% of identity |
Eggnog | Ccr4-NOT transcription complex, subunit(COG5103) |
Kegg | Link to kegg annotations (100036630) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435205.1) |
Pfam | CCR4-Not complex component, Not1 (PF04054.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer