| Transcript | Ll_transcript_412110 |
|---|---|
| CDS coordinates | 973-1305 (+) |
| Peptide sequence | MTGKYIPTYYLFTFLLFNSCLEEGAEDFLLKPVKLSDVKRLTDFMRGEGKIAEKQSPKRRQSDNCTPSLSTMFSLTSYHRNITSPELLPSLSPSASPSKKSRVSKKIELC* |
| ORF Type | complete |
| Blastp | Two-component response regulator ARR3 from Arabidopsis with 43.48% of identity |
|---|---|
| Blastx | Two-component response regulator ARR3 from Arabidopsis with 42.42% of identity |
| Eggnog | Transcription factor(COG5641) |
| Kegg | Link to kegg annotations (AT1G59940) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019416226.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer