Protein coding transcript 123590

• Transcript: Ll_transcript_507061
• CDS coordinates: 308-1030 (+)
• Peptide sequence: MTCAFSPSAQSVACGGLDSVCSIFNINSPTDRDGNLTVSRTLTGHKGYVSSCQYVPDQDTHLITGSGDQTCVLWDITTGLRTSVFGGEFQSGHTADVLSISINGSNSRMFVSGSCDATARLWDTRVASRAVRIFHGHEGDVSSVKFFPDGNRFGTGSEDGTCRLFDIRTGHQLQVYHNQHCDNETAHVTSIAFSISGRLLFAGYTNGHCYVWDTLLAKVVLNLGSLQNSHENRISCLGLSA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_507061

• Blastp: Guanine nucleotide-binding protein subunit beta-2 from Nicotiana with 83.82% of identity
• Blastx: Guanine nucleotide-binding protein subunit beta from Nicotiana with 86.08% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107760597)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416487.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;