Protein coding transcript 123594

• Transcript: Ll_transcript_507067
• CDS coordinates: 2-1168 (+)
• Peptide sequence: MQSPQQLQPMSFLAIDVYAKLVFSILKGSSKLTLLSKILAVTVRFILKDVEERKTSFNPRPYFRLFINWLLDLGSLEPVTDGANLQILTAFANAFHALQPLKVPGFSFAWLELISHRSFMPKMLTGNAQKGWPYIQRLLVDLFQFMEPFLRHAELGDSVRLLYKGTLRVLLVLLHDFPEFLCDYHFTFCDVIPPSCIQMRNIILSAFPRSMRLPDPSTPNLKIDLLQEITQSPRILSEVDAVLKAKLMKADVDEYLKSRQQNSSFLSELKEKLLLSPNEAGSAGTRYNVPLINSLVLYVGMQAIQQLQGRTPHAQSSANAFPLAVFSVGAALDIFQTLIMDLDTEGRYLFLNAVANQLRYPNTHTHYFSFILLYLFAESNQVLSSFNL*
• ORF Type: complete

Annotations of Ll_transcript_507067

• Blastp: CCR4-NOT transcription complex subunit 1 from Silurana with 53.35% of identity
• Blastx: CCR4-NOT transcription complex subunit 1 from Silurana with 54.65% of identity
• Eggnog: Ccr4-NOT transcription complex, subunit(COG5103)
• Kegg: Link to kegg annotations (100036630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433885.1)
• Pfam: CCR4-Not complex component, Not1 (PF04054.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;