Protein coding transcript 123595

• Transcript: Ll_transcript_507068
• CDS coordinates: 2-916 (+)
• Peptide sequence: MQSPQQLQPMSFLAIDVYAKLVFSILKGSSKLTLLSKILAVTVRFILKDVEERKTSFNPRPYFRLFINWLLDLGSLEPVTDGANLQILTAFANAFHALQPLKVPGFSFAWLELISHRSFMPKMLTGNAQKGWPYIQRLLVDLFQFMEPFLRHAELGDSVRLLYKGTLRVLLVLLHDFPEFLCDYHFTFCDVIPPSCIQMRNIILSAFPRSMRLPDPSTPNLKIDLLQEITQSPRILSEVDAVLKAKLMKADVDEYLKSRQQNSSFLSELKEKLLLSPNEAGSAGTRYNVPLINSLVLYVGMQVP*
• ORF Type: complete

Annotations of Ll_transcript_507068

• Blastp: CCR4-NOT transcription complex subunit 1 from Silurana with 52.43% of identity
• Blastx: CCR4-NOT transcription complex subunit 1 from Silurana with 53.96% of identity
• Eggnog: Ccr4-NOT transcription complex, subunit(COG5103)
• Kegg: Link to kegg annotations (100036630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435205.1)
• Pfam: CCR4-Not complex component, Not1 (PF04054.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;