Protein coding transcript 123597

• Transcript: Ll_transcript_507040
• CDS coordinates: 639-956 (+)
• Peptide sequence: MAKTRRLNCLLENEADPNIRDCNGKLPLWEALQHGHTLMRDKLIQYGTIIEQHDKFGFVSFATTQNDNTLMQEILQYHITLPTIASLVEECHEHESDVHMRHNYY*
• ORF Type: complete

Annotations of Ll_transcript_507040

• Blastp: Potassium channel AKT1 from Arabidopsis with 40.26% of identity
• Blastx: Potassium channel AKT1 from Oryza sativa with 27.57% of identity
• Eggnog: Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE)
• Kegg: Link to kegg annotations (AT2G26650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427311.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;