Protein coding transcript 123602

• Transcript: Ll_transcript_507045
• CDS coordinates: 508-870 (+)
• Peptide sequence: MCSLILLQNEHLATSMAKTRRLNCLLENEADPNIRDCNGKLPLWEALQHGHTLMRDKLIQYGTIIEQHDKFGFVSFATTQNDNTLMQEILQYHITLPTIASLVEECHEHESDVHMRHNYY*
• ORF Type: complete

Annotations of Ll_transcript_507045

• Blastp: CCR4-NOT transcription complex subunit 1 from Silurana with 30.85% of identity
• Blastx: Potassium channel AKT1 from Oryza sativa with 35.37% of identity
• Eggnog: Ccr4-NOT transcription complex, subunit(COG5103)
• Kegg: Link to kegg annotations (100036630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427311.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;